PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000165523
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 539aa    MW: 60749.9 Da    PI: 6.623
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000165523genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.41.9e-141559348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      W++eEd++l + + ++G+++W+ Ia+++   +t  qc+ rw++yl
    MDP0000165523 15 TWSQEEDDILRNQISLHGTENWAVIASKFK-DKTTRQCRRRWYTYL 59
                     6****************************9.*************97 PP

2Myb_DNA-binding43.47.8e-1465108146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g W++eEd ll +a k +G++ W+ Ia+ +  gRt++ +k+r+ +
    MDP0000165523  65 KGGWSPEEDMLLCEAQKIFGNR-WTEIAKVVS-GRTDNAVKNRFST 108
                      688*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.436859IPR017930Myb domain
SMARTSM007171.9E-131261IPR001005SANT/Myb domain
SuperFamilySSF466891.65E-2512106IPR009057Homeodomain-like
CDDcd001674.05E-131559No hitNo description
Gene3DG3DSA:1.10.10.602.6E-201666IPR009057Homeodomain-like
PfamPF139213.0E-151676No hitNo description
PROSITE profilePS5129420.05560114IPR017930Myb domain
SMARTSM007171.1E-1464112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-1967113IPR009057Homeodomain-like
CDDcd001679.98E-1168109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 539 aa     Download sequence    Send to blast
MPQEESKKKE RHIVTWSQEE DDILRNQISL HGTENWAVIA SKFKDKTTRQ CRRRWYTYLN  60
SDFKKGGWSP EEDMLLCEAQ KIFGNRWTEI AKVVSGRTDN AVKNRFSTLC KKRAKYEALA  120
KENANSYINQ NDKRVIIRNG FNTDGTTETT APPKKMRRSH IPILSKNCTS GDRLPDQCGK  180
INQQLRPPFT VLIQNAHNVE NLQDQHNGHS XKEVPGNAVQ NSKFQGSFLE KDDPKIIALM  240
QQAELLSSLA LKVNSENTDQ SLENAWMVLQ DFLNQSKDSD ILSYGIDDFD FQLEDLKYLL  300
EDLRSTTEGS RPSWQQPDLF DDSPGSSEYS TGSTLLSQTE CYQVEQNEVE IGSPNQEIRL  360
GSHSIPIEGQ NDVXDCEKGI VSEKQEIFPS CDEGRKDYAV VSALSNTEFT SPFKVVPLFR  420
SLAAGIPSPK FSESERNFLL KTLGEDSPCP IPSTNPSQPP PCKRSLLQRL QPFQPKILQM  480
GSCTEPAMSL VIQECKTTRV MAGVKEAPSL RFFCLDSVLK WGRRVARPKT VFGGGGGQV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-261611310107B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.84990.0fruit| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008339925.10.0PREDICTED: uncharacterized protein LOC103402919
TrEMBLD9ZJ680.0D9ZJ68_MALDO; MYB domain class transcription factor
STRINGVIT_01s0026g01910.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34803461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14350.21e-160MYB family protein